SWISS-MODEL Homology Modelling Report

Model Building Report

This document lists the results for the homology modelling project "4_1_Oct_SF_Bin32_scaffold_7496_c2_2-505_1" submitted to SWISS-MODEL workspace on March 29, 2023, 8:50 p.m..The submitted primary amino acid sequence is given in Table T1.

If you use any results in your research, please cite the relevant publications:

Results

The SWISS-MODEL template library (SMTL version 2023-03-23, PDB release 2023-03-17) was searched with for evolutionary related structures matching the target sequence in Table T1. For details on the template search, see Materials and Methods. Overall 221 templates were found (Table T2).

Models

The following model was built (see Materials and Methods "Model Building"):

Model #01

File Built with Oligo-State Ligands GMQE QMEANDisCo Global
PDB ProMod3 3.2.1 monomer
None
0.49 0.59 ± 0.08
Template Seq Identity Oligo-state QSQE Found by Method Resolution Seq Similarity Range Coverage Description
7b04.1.B 44.60 monomer 0.00 HHblits X-ray 2.97Å 0.42 30 - 148 0.83 Nitrite oxidoreductase subunit A

Excluded ligands

Ligand Name.Number Reason for Exclusion Description
CA.10 Binding site not conserved.
CALCIUM ION
CA.11 Binding site not conserved.
CALCIUM ION
F3S.4 Binding site not conserved.
FE3-S4 CLUSTER
HEM.9 Binding site not conserved.
PROTOPORPHYRIN IX CONTAINING FE
MD1.5 Binding site not conserved.
PHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YL ESTER GUANYLATE ESTER
MD1.6 Binding site not conserved.
PHOSPHORIC ACID 4-(2-AMINO-4-OXO-3,4,5,6,-TETRAHYDRO-PTERIDIN-6-YL)-2-HYDROXY-3,4-DIMERCAPTO-BUT-3-EN-YL ESTER GUANYLATE ESTER
MO.7 Binding site not conserved.
MOLYBDENUM ATOM
SF4.1 Binding site not conserved.
IRON/SULFUR CLUSTER
SF4.2 Binding site not conserved.
IRON/SULFUR CLUSTER
SF4.3 Binding site not conserved.
IRON/SULFUR CLUSTER
SF4.8 Binding site not conserved.
IRON/SULFUR CLUSTER

Target    MAQGVSRRQLLGRALALGSGAALADLLGPARFLSPAGAATAGAVVPGNPLRVMPDRTWEQIYRNQFEDDSTFVFTCAPND
7b04.1.B --MKLTRRAFLQVAGATGATLTLAKNAMAFRLL-------KPAVVVDNPLDTYPDRRWESVYRDQYQYDRTFTYCCSPND

Target THNCLLRAHVKNGVVVRISPTYGYGEATDLYGNRASHRWDPRTCQKGLILSRRFYSERRVKAPMIRKGFKDWVEAGYPRN
7b04.1.B THACRIRAFVRNNVMMRVEQNYDHQNYSDLYGNKATRNWNPRMCLKGYTFHRRVYGPYRLRYPLIRKG------------

Target DDGTPQM
7b04.1.B -------




Materials and Methods

Template Search

Template search with has been performed against the SWISS-MODEL template library (SMTL, last update: 2023-03-23, last included PDB release: 2023-03-17).

Template Selection

For each identified template, the template's quality has been predicted from features of the target-template alignment. The templates with the highest quality have then been selected for model building.

Model Building

Models are built based on the target-template alignment using ProMod3 (Studer et al.). Coordinates which are conserved between the target and the template are copied from the template to the model. Insertions and deletions are remodelled using a fragment library. Side chains are then rebuilt. Finally, the geometry of the resulting model is regularized by using a force field.

Model Quality Estimation

The global and per-residue model quality has been assessed using the QMEAN scoring function (Studer et al.).

Ligand Modelling

Ligands present in the template structure are transferred by homology to the model when the following criteria are met: (a) The ligands are annotated as biologically relevant in the template library, (b) the ligand is in contact with the model, (c) the ligand is not clashing with the protein, (d) the residues in contact with the ligand are conserved between the target and the template. If any of these four criteria is not satisfied, a certain ligand will not be included in the model. The model summary includes information on why and which ligand has not been included.

Oligomeric State Conservation

The quaternary structure annotation of the template is used to model the target sequence in its oligomeric form. The method (Bertoni et al.) is based on a supervised machine learning algorithm, Support Vector Machines (SVM), which combines interface conservation, structural clustering, and other template features to provide a quaternary structure quality estimate (QSQE). The QSQE score is a number between 0 and 1, reflecting the expected accuracy of the interchain contacts for a model built based a given alignment and template. Higher numbers indicate higher reliability. This complements the GMQE score which estimates the accuracy of the tertiary structure of the resulting model.

References

Table T1:

Primary amino acid sequence for which templates were searched and models were built.

MAQGVSRRQLLGRALALGSGAALADLLGPARFLSPAGAATAGAVVPGNPLRVMPDRTWEQIYRNQFEDDSTFVFTCAPNDTHNCLLRAHVKNGVVVRISP
TYGYGEATDLYGNRASHRWDPRTCQKGLILSRRFYSERRVKAPMIRKGFKDWVEAGYPRNDDGTPQM

Table T2:

Template Seq Identity Oligo-state QSQE Found by Method Resolution Seq Similarity Coverage Description
7b04.1.B 44.60 monomer - HHblits X-ray 2.97Å 0.42 0.83 Nitrite oxidoreductase subunit A
7b04.2.B 44.60 monomer - HHblits X-ray 2.97Å 0.42 0.83 Nitrite oxidoreductase subunit A
7b04.2.B 47.32 monomer - BLAST X-ray 2.97Å 0.46 0.67 Nitrite oxidoreductase subunit A
7b04.1.B 47.32 monomer - BLAST X-ray 2.97Å 0.46 0.67 Nitrite oxidoreductase subunit A
3ir5.1.A 28.21 monomer - HHblits X-ray 2.30Å 0.34 0.70 Respiratory nitrate reductase 1 alpha chain
1q16.1.A 26.50 monomer - HHblits X-ray 1.90Å 0.33 0.70 Respiratory nitrate reductase 1 alpha chain
3ir7.1.A 26.50 monomer - HHblits X-ray 2.50Å 0.32 0.70 Respiratory nitrate reductase 1 alpha chain
3ir6.1.A 27.35 monomer - HHblits X-ray 2.80Å 0.33 0.70 Respiratory nitrate reductase 1 alpha chain
1r27.4.A 34.31 homo-dimer 0.12 BLAST X-ray 2.00Å 0.36 0.61 Respiratory nitrate reductase 1 alpha chain
3ir5.1.A 35.29 monomer - BLAST X-ray 2.30Å 0.37 0.61 Respiratory nitrate reductase 1 alpha chain
3ir6.1.A 34.31 monomer - BLAST X-ray 2.80Å 0.36 0.61 Respiratory nitrate reductase 1 alpha chain
1r27.4.A 26.09 homo-dimer 0.11 HHblits X-ray 2.00Å 0.32 0.69 Respiratory nitrate reductase 1 alpha chain
3m9s.1.C 22.08 monomer - HHblits X-ray 4.50Å 0.30 0.46 NADH-quinone oxidoreductase subunit 3
6q8o.1.C 22.08 monomer - HHblits X-ray 3.61Å 0.30 0.46 NADH-quinone oxidoreductase subunit 3
6zjl.1.C 22.08 monomer - HHblits EM NA 0.30 0.46 NADH-quinone oxidoreductase subunit 3
6zjn.1.C 22.08 monomer - HHblits EM NA 0.30 0.46 NADH-quinone oxidoreductase subunit 3
2fug.2.C 22.08 monomer - HHblits X-ray 3.30Å 0.30 0.46 NADH-quinone oxidoreductase chain 3
6zjy.1.C 22.08 monomer - HHblits EM NA 0.30 0.46 NADH-quinone oxidoreductase subunit 3
6ziy.1.C 22.08 monomer - HHblits EM NA 0.30 0.46 NADH-quinone oxidoreductase subunit 3
5xtb.1.L 14.10 monomer - HHblits EM NA 0.26 0.47 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
6qcf.1.C 13.75 monomer - HHblits EM NA 0.26 0.48 NADH:ubiquinone oxidoreductase core subunit S1
6qc5.1.C 13.75 monomer - HHblits EM NA 0.26 0.48 NADH:ubiquinone oxidoreductase core subunit S1
6zk9.1.C 14.29 monomer - HHblits EM NA 0.26 0.46 NADH:ubiquinone oxidoreductase core subunit S1
7v2c.1.L 15.58 monomer - HHblits EM NA 0.26 0.46 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
7qsd.1.G 14.29 monomer - HHblits EM NA 0.26 0.46 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
5o31.1.8 14.10 monomer - HHblits EM 4.13Å 0.26 0.47 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
7dgr.10.A 14.10 monomer - HHblits EM NA 0.26 0.47 NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

The table above shows the top 27 filtered templates. A further 193 templates were found which were considered to be less suitable for modelling than the filtered list.
1aa6.1.A, 1bcc.1.O, 1be3.1.E, 1bgy.1.P, 1dms.1.A, 1e18.1.A, 1e5v.2.A, 1e60.1.A, 1eu1.1.A, 1fdo.1.A, 1g8j.1.A, 1g8k.1.A, 1h0h.1.A, 1kb9.1.E, 1kqf.1.A, 1l0l.1.E, 1l0n.1.E, 1ntk.1.E, 1ntm.1.E, 1ogy.1.A, 1q16.1.A, 1q90.1.E, 1sqb.1.E, 1sqp.1.P, 1sqq.1.P, 1sqv.1.E, 1tmo.1.A, 1vf5.1.D, 1vf5.1.L, 1zrt.1.C, 1zrt.1.F, 2d2c.1.D, 2d2c.1.L, 2e75.1.D, 2e76.1.D, 2e7z.1.A, 2fyn.1.C, 2fyn.2.C, 2fyu.1.E, 2iv2.1.A, 2ivf.1.A, 2nya.1.A, 2o01.1.H, 2pq4.1.B, 2qjk.1.C, 2qjp.1.C, 2qjy.3.F, 2v3v.1.A, 2v45.1.A, 2vpx.1.D, 2vpz.1.A, 2ybb.1.b, 3bcc.1.E, 3cwb.1.E, 3egw.1.A, 3h1h.1.E, 3h1h.1.O, 3h1i.1.E, 3ir7.1.A, 3l75.1.E, 3l75.1.O, 3lw5.1.H, 3o5a.1.A, 4aay.1.A, 4d6t.1.E, 4dmr.1.A, 4h44.1.D, 4ogq.1.L, 4pv1.1.L, 4rku.1.H, 4u3f.1.E, 4v4c.1.A, 4ydd.1.A, 5e7o.1.A, 5gpn.17.A, 5gpn.24.A, 5gpn.5.A, 5gup.54.A, 5gup.56.A, 5j8k.55.A, 5kkz.1.C, 5kli.1.C, 5klv.1.P, 5nmi.1.E, 5nqd.1.A, 5okd.1.E, 5t5i.1.B, 5xte.1.C, 6adq.1.L, 6btm.1.B, 6cz7.1.A, 6f0k.1.B, 6fo0.1.E, 6fo6.1.J, 6g72.1.G, 6gcs.1.A, 6giq.1.E, 6hu9.1.E, 6hwh.1.A, 6lod.1.B, 6nhg.1.E, 6nin.1.C, 6q9e.1.E, 6q9e.1.O, 6qbx.15.A, 6qbx.5.A, 6qc2.33.A, 6qc2.43.A, 6qc3.15.A, 6qc3.5.A, 6qc4.15.A, 6qc4.5.A, 6rfq.1.A, 6rfs.1.A, 6rqf.1.D, 6rqf.1.L, 6sdr.1.A, 6sdv.1.A, 6t0b.1.E, 6t0b.1.O, 6t15.1.E, 6t15.1.O, 6tg9.1.A, 6x89.1.H, 6yj4.1.G, 6ymx.1.Q, 6ymx.1.Z, 6zr2.1.G, 7a23.1.O, 7ak5.1.G, 7ak6.1.G, 7aqr.1.F, 7ar7.1.G, 7ar8.1.G, 7arc.1.F, 7bkb.1.F, 7bkb.1.L, 7dgr.60.A, 7dgs.50.A, 7dgs.60.A, 7e1v.1.P, 7e5z.1.A, 7ewk.1.G, 7jrg.1.E, 7l5i.1.A, 7l5s.1.A, 7nz1.1.E, 7o37.1.E, 7o37.1.O, 7o3c.1.E, 7o3c.1.O, 7o3h.1.E, 7o3h.1.O, 7p61.1.C, 7p63.1.C, 7q21.1.G, 7q5y.1.A, 7qhm.1.A, 7qhm.1.N, 7qho.1.A, 7qrm.1.D, 7qv7.1.L, 7qv7.1.O, 7r0w.1.L, 7r0w.1.Q, 7rh5.1.V, 7rja.1.H, 7rjb.1.I, 7t2r.1.A, 7t30.1.A, 7tce.2.F, 7tgh.58.A, 7tlj.1.C, 7tz6.1.E, 7tz6.1.P, 7vw6.1.A, 7vxu.1.L, 7z0t.1.G, 7zd6.1.4, 7zm7.1.I, 7zxy.1.D, 7zxy.1.L, 8asi.1.A, 8asi.1.E, 8asj.1.E, 8b9z.1.G, 8ba0.1.G, 8bel.1.B, 8bel.1.I, 8bpx.51.A, 8bqg.1.A, 8e73.55.A, 8e9g.1.G